PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID SapurV1A.0867s0160.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Salix
Family NAC
Protein Properties Length: 367aa    MW: 41339.6 Da    PI: 7.6178
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
SapurV1A.0867s0160.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM169.98.1e-5381441128
                     NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatg 87 
                             lppGfrFhPtdeel+ +yLkkk++++++++ +vi++vdiyk++PwdLp+++  +ekewyfFs+rd+ky++g r+nra++sgyWkatg
  SapurV1A.0867s0160.1.p   8 LPPGFRFHPTDEELILHYLKKKLASTPFPV-SVIADVDIYKFDPWDLPAQAVLGEKEWYFFSPRDRKYPNGARPNRAAASGYWKATG 93 
                             79****************************.99***************8777899******************************** PP

                     NAM  88 kdkevlsk..........kgelvglkktLvfykgrapkgektdWvmheyrl 128
                             +dk ++++          ++e++g+kk Lvfy+g+ pkg+ktdW+mheyrl
  SapurV1A.0867s0160.1.p  94 TDKIIMAStmapkgvvigGQENIGVKKALVFYRGKPPKGVKTDWIMHEYRL 144
                             ******9989998888877778***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019411.23E-635176IPR003441NAC domain
PROSITE profilePS5100561.0078176IPR003441NAC domain
PfamPF023652.8E-279144IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 367 aa     Download sequence    Send to blast
MKNPQSSLPP GFRFHPTDEE LILHYLKKKL ASTPFPVSVI ADVDIYKFDP WDLPAQAVLG  60
EKEWYFFSPR DRKYPNGARP NRAAASGYWK ATGTDKIIMA STMAPKGVVI GGQENIGVKK  120
ALVFYRGKPP KGVKTDWIMH EYRLADTPTY TNIISTKPKD SSMRLDDWVL CRIYKKSLAL  180
TSSPRALISS EHGQEEEEEE QRFVEETLLP ISSKNTLMPQ KSCSFSNLFD ATDYSMLRSF  240
LADTQFNPAG FESNPSLNGS TAQLDQTFFG NSDSASNSNS TSSDYFLQKL PQLNNSTPNY  300
MHENKLKRQL SHLDEEMPLP SKKYANSCSF TNTSNNIQTD MGQYSFLSQQ FLNQQLLLSP  360
HLQFTG*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4dul_B3e-71517614165NAC domain-containing protein 19
4dul_A3e-71517614165NAC domain-containing protein 19
1ut7_B3e-71517614165NO APICAL MERISTEM PROTEIN
1ut7_A3e-71517614165NO APICAL MERISTEM PROTEIN
1ut4_B3e-71517614165NO APICAL MERISTEM PROTEIN
1ut4_A3e-71517614165NO APICAL MERISTEM PROTEIN
3swp_D4e-71517617168NAC domain-containing protein 19
3swp_C4e-71517617168NAC domain-containing protein 19
3swp_B4e-71517617168NAC domain-containing protein 19
3swp_A4e-71517617168NAC domain-containing protein 19
3swm_D4e-71517617168NAC domain-containing protein 19
3swm_C4e-71517617168NAC domain-containing protein 19
3swm_B4e-71517617168NAC domain-containing protein 19
3swm_A4e-71517617168NAC domain-containing protein 19
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC2167711e-117AC216771.1 Populus trichocarpa clone POP051-N07, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002319143.20.0hypothetical protein POPTR_0013s05080g
TrEMBLB9I5U70.0B9I5U7_POPTR; Uncharacterized protein
STRINGPOPTR_0013s05080.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF66212750
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G04070.11e-108NAC domain containing protein 47